PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017253P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 336aa    MW: 36025.6 Da    PI: 8.0935
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017253P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-393394263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+sss
  MELO3C017253P1 33 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSSS 94
                    57899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273491IPR003851Zinc finger, Dof-type
PfamPF027013.0E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MQDIHSIAGG SRLFGGGGGG DRRLRPHLHH HQNHQALKCP RCDSLNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTKGGVLRNV PVGGGCRKTK RSSSSKSKSN SSSDAVATPP PPPPPALPLP  120
PRDRKSTSHS SSESSSLTAT TTTAAVATEA VSAPSSNSAS ALLNVHDTKL FTGSSTTNTN  180
PNFEVPDCGI FSEIGSFTSL ITSSNETLPF GFGNMADVTA FAMNNHHQFQ NQTANQWPPP  240
PPPPSQRMMN VNDELKIQGM TTDSGGGGGG GGGGYMDQTG QMDPNSRSNN IGFGALDWQS  300
NGDHQVLFDL PTAVDQAYWS QNQWNDQDQP NLYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453317.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A0A0LSJ31e-163A0A0A0LSJ3_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s12670.11e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-36OBF binding protein 4